PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK26915.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB
Protein Properties Length: 273aa    MW: 31353.2 Da    PI: 9.7562
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK26915.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.31.3e-162065147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ed +l+++v  +G+ +W+ Ia++m+ gRt+k+c++rw++ 
       KFK26915.1 20 RGHWKPSEDFKLKELVSVFGPQNWNYIAEKMQ-GRTGKSCRLRWFNQ 65
                     899*****************************.***********996 PP

2Myb_DNA-binding52.61e-1675116447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +T eE+e+l+ +++++G++ W++Ia+ ++ gRt++ +k++w+ +
       KFK26915.1  75 FTDEEEEKLLAVHREFGNK-WSLIAKLFN-GRTDNAVKNHWHVL 116
                      9******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0611566IPR017930Myb domain
SMARTSM007178.1E-121968IPR001005SANT/Myb domain
SuperFamilySSF466895.19E-2820117IPR009057Homeodomain-like
PfamPF002494.6E-152065IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-262173IPR009057Homeodomain-like
CDDcd001671.39E-102364No hitNo description
PROSITE profilePS5129425.57867121IPR017930Myb domain
SMARTSM007172.0E-1471119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-2174121IPR009057Homeodomain-like
PfamPF002491.9E-1475116IPR001005SANT/Myb domain
CDDcd001676.41E-1175117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MHQESKKSKK KKNLSRVCSR GHWKPSEDFK LKELVSVFGP QNWNYIAEKM QGRTGKSCRL  60
RWFNQLDPRI NKRGFTDEEE EKLLAVHREF GNKWSLIAKL FNGRTDNAVK NHWHVLMARK  120
LRKQSTSYTM KSHNNTLSPH NLTSSDKTEA DNTDEVTCLN PQQTFNLFPG SAGDDKSYSW  180
KMLKEETTNL KDQYLQEEYC SSRMPMKYSG HHHQFSTFSA DSLALLTPHV SISQPSSSSS  240
SLSSSEAENT MVARYFETTL PPRFIDFLGV GAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A8e-30201214105MYB PROTO-ONCOGENE PROTEIN
1h88_C4e-292012158159MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-292012158159MYB PROTO-ONCOGENE PROTEIN
1mse_C8e-30201214105C-Myb DNA-Binding Domain
1msf_C8e-30201214105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2727321e-91AF272732.1 Arabidopsis thaliana putative transcription factor (MYB110) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013613545.11e-116PREDICTED: transcriptional activator Myb-like
TrEMBLA0A087GAL30.0A0A087GAL3_ARAAL; Uncharacterized protein
STRINGBra025652.1-P1e-113(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63001846
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G29020.21e-108myb domain protein 110